SCOPe 2.01: Domain d3leza_: 3lez A:

Lineage for d3leza_ (3lez A:)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (13 species)
   not a true protein

7. Species Oceanobacillus iheyensis [TaxId:182710] [189232] (1 PDB entry)

8. Domain d3leza_: 3lez A: [180239]
   automated match to d1i2sa_
   complexed with ca, cl, epe

Details for d3leza_

PDB Entry: 3lez, 1.25 Å

PDB Description: Crystal structure of a halotolerant bacterial beta-lactamase

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3leza_:

Sequence; same for both SEQRES and ATOM records:

>d3leza_ e.3.1.1 (A:) automated matches {Oceanobacillus iheyensis [TaxId: 182710]}
gsedlkkleeefdvrlgvyaidtgadkeisyrenerfaytstfkplavgavlqtksdeel
eetityseedlvtyspiteqhvdegmtlveiadaairysdntagnllleamggpdeleti
lrdigdetiemdryetelneakpgdirdtstakamattlqqyvledvldadrrevltnml
innttgdaliragvpdgwtvgdktgaggygtrndigiiwpegdeepiviaimssrdeeda
dyddkliekateivlqelrn

Timeline for d3leza_:

• d3leza_ is new in SCOPe 2.01-stable
  
• d3leza_ appears in SCOPe 2.02
  
• d3leza_ appears in the current release, SCOPe 2.08