Lineage for d3leza_ (3lez A:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1054403Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1054404Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1054405Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1054945Protein automated matches [190161] (13 species)
    not a true protein
  7. 1055042Species Oceanobacillus iheyensis [TaxId:182710] [189232] (1 PDB entry)
  8. 1055043Domain d3leza_: 3lez A: [180239]
    automated match to d1i2sa_
    complexed with ca, cl, epe

Details for d3leza_

PDB Entry: 3lez (more details), 1.25 Å

PDB Description: Crystal structure of a halotolerant bacterial beta-lactamase
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3leza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3leza_ e.3.1.1 (A:) automated matches {Oceanobacillus iheyensis [TaxId: 182710]}
gsedlkkleeefdvrlgvyaidtgadkeisyrenerfaytstfkplavgavlqtksdeel
eetityseedlvtyspiteqhvdegmtlveiadaairysdntagnllleamggpdeleti
lrdigdetiemdryetelneakpgdirdtstakamattlqqyvledvldadrrevltnml
innttgdaliragvpdgwtvgdktgaggygtrndigiiwpegdeepiviaimssrdeeda
dyddkliekateivlqelrn

SCOPe Domain Coordinates for d3leza_:

Click to download the PDB-style file with coordinates for d3leza_.
(The format of our PDB-style files is described here.)

Timeline for d3leza_: