![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H3 [47122] (6 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries) |
![]() | Domain d3lelk_: 3lel K: [180231] Other proteins in same PDB: d3lelb_, d3lelc_, d3leld_, d3lelf_, d3lelg_, d3lelh_, d3lell_, d3lelm_, d3leln_, d3lelp_, d3lelq_, d3lelr_ automated match to d1kx5a_ protein/DNA complex; complexed with mn |
PDB Entry: 3lel (more details), 2.95 Å
SCOPe Domain Sequences for d3lelk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lelk_ a.22.1.1 (K:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]} kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas eaylvalfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d3lelk_: