Lineage for d3lelm_ (3lel M:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082620Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1082621Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 1082622Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1082623Protein Histone H2A [47115] (6 species)
  7. 1082624Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (33 PDB entries)
  8. 1082685Domain d3lelm_: 3lel M: [191761]
    Other proteins in same PDB: d3lela_, d3lelb_, d3leld_, d3lele_, d3lelf_, d3lelh_, d3lelk_, d3lell_, d3leln_, d3lelo_, d3lelp_, d3lelr_
    automated match to d1kx5c_
    protein/DNA complex; complexed with mn

Details for d3lelm_

PDB Entry: 3lel (more details), 2.95 Å

PDB Description: Structural Insight into the Sequence-Dependence of Nucleosome Positioning
PDB Compounds: (M:) histone h2a

SCOPe Domain Sequences for d3lelm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lelm_ a.22.1.1 (M:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
ktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt

SCOPe Domain Coordinates for d3lelm_:

Click to download the PDB-style file with coordinates for d3lelm_.
(The format of our PDB-style files is described here.)

Timeline for d3lelm_: