Lineage for d3le7b_ (3le7 B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1225633Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1225634Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1225635Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1225771Protein automated matches [190420] (8 species)
    not a true protein
  7. 1225820Species Phytolacca dioica [TaxId:29725] [188356] (6 PDB entries)
  8. 1225828Domain d3le7b_: 3le7 B: [180218]
    automated match to d1gika_
    complexed with ade, nag

Details for d3le7b_

PDB Entry: 3le7 (more details), 1.65 Å

PDB Description: crystal structure of pd-l1 from p. dioica in complex with adenine
PDB Compounds: (B:) Ribosome-inactivating protein PD-L1/PD-L2

SCOPe Domain Sequences for d3le7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3le7b_ d.165.1.1 (B:) automated matches {Phytolacca dioica [TaxId: 29725]}
intitydagnttinkyatfmeslrneakdpslqcygipmlpnnsstikyllvklqgasqk
titlmlrrnnlyvmgysdpfngncryhifnditgtertnventlcsssssrdakpinyns
lystlekkaevnsrsqvqlgiqilssdigkisgqssftdkteakfllvaiqmvseaarfk
yienqvktnfnrdfspndkildleenwgkistaihdatngalpkplelknadgtkwivlr
vdeikpdmgllnyvngtcqtt

SCOPe Domain Coordinates for d3le7b_:

Click to download the PDB-style file with coordinates for d3le7b_.
(The format of our PDB-style files is described here.)

Timeline for d3le7b_: