SCOPe 2.03: Domain d3le7b_: 3le7 B:

Lineage for d3le7b_ (3le7 B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein automated matches [190420] (8 species)
   not a true protein

7. Species Phytolacca dioica [TaxId:29725] [188356] (6 PDB entries)

8. Domain d3le7b_: 3le7 B: [180218]
   automated match to d1gika_
   complexed with ade, nag

Details for d3le7b_

PDB Entry: 3le7, 1.65 Å

PDB Description: crystal structure of pd-l1 from p. dioica in complex with adenine

PDB Compounds: (B:) Ribosome-inactivating protein PD-L1/PD-L2

SCOPe Domain Sequences for d3le7b_:

Sequence; same for both SEQRES and ATOM records:

>d3le7b_ d.165.1.1 (B:) automated matches {Phytolacca dioica [TaxId: 29725]}
intitydagnttinkyatfmeslrneakdpslqcygipmlpnnsstikyllvklqgasqk
titlmlrrnnlyvmgysdpfngncryhifnditgtertnventlcsssssrdakpinyns
lystlekkaevnsrsqvqlgiqilssdigkisgqssftdkteakfllvaiqmvseaarfk
yienqvktnfnrdfspndkildleenwgkistaihdatngalpkplelknadgtkwivlr
vdeikpdmgllnyvngtcqtt

Timeline for d3le7b_:

• d3le7b_ first appeared in SCOPe 2.01
  
• d3le7b_ appears in SCOPe 2.02
  
• d3le7b_ appears in SCOPe 2.04
  
• d3le7b_ appears in the current release, SCOPe 2.08