SCOPe 2.08: Domain d3ldqb1: 3ldq B:151-260

Lineage for d3ldqb1 (3ldq B:151-260)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.7: BAG domain [63491] (1 family)

5. Family a.7.7.1: BAG domain [63492] (4 proteins)
   Pfam PF02179
   this is a repeat family; one repeat unit is 1hx1 B:151-261 found in domain

6. Protein BAG-family molecular chaperon regulator-1, BAG1 [63493] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63494] (8 PDB entries)

8. Domain d3ldqb1: 3ldq B:151-260 [180199]
   Other proteins in same PDB: d3ldqa1, d3ldqa2, d3ldqb2
   automated match to d1hx1b_
   complexed with 3p1

Details for d3ldqb1

PDB Entry: 3ldq, 1.9 Å

PDB Description: Crystal structure of HSC70/BAG1 in complex with small molecule inhibitor

PDB Compounds: (B:) BAG family molecular chaperone regulator 1

SCOPe Domain Sequences for d3ldqb1:

Sequence; same for both SEQRES and ATOM records:

>d3ldqb1 a.7.7.1 (B:151-260) BAG-family molecular chaperon regulator-1, BAG1 {Human (Homo sapiens) [TaxId: 9606]}
nspqeevelkklkhleksvekiadqleelnkeltgiqqgflpkdlqaealckldrrvkat
ieqfmkileeidtlilpenfkdsrlkrkglvkkvqaflaecdtveqnicq

Timeline for d3ldqb1:

• d3ldqb1 first appeared in SCOPe 2.01, called d3ldqb_
  
• d3ldqb1 appears in SCOPe 2.07