SCOPe 2.01: Domain d3ldqb_: 3ldq B:

Lineage for d3ldqb_ (3ldq B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.7: BAG domain [63491] (1 family)

5. Family a.7.7.1: BAG domain [63492] (5 proteins)
   Pfam PF02179
   this is a repeat family; one repeat unit is 1hx1 B:151-261 found in domain

6. Protein automated matches [191022] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188815] (7 PDB entries)

8. Domain d3ldqb_: 3ldq B: [180199]
   automated match to d1hx1b_
   complexed with 3p1

Details for d3ldqb_

PDB Entry: 3ldq, 1.9 Å

PDB Description: Crystal structure of HSC70/BAG1 in complex with small molecule inhibitor

PDB Compounds: (B:) BAG family molecular chaperone regulator 1

SCOPe Domain Sequences for d3ldqb_:

Sequence; same for both SEQRES and ATOM records:

>d3ldqb_ a.7.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gnspqeevelkklkhleksvekiadqleelnkeltgiqqgflpkdlqaealckldrrvka
tieqfmkileeidtlilpenfkdsrlkrkglvkkvqaflaecdtveqnicq

Timeline for d3ldqb_:

• d3ldqb_ is new in SCOPe 2.01-stable
  
• d3ldqb_ appears in SCOPe 2.02
  
• d3ldqb_ appears in the current release, SCOPe 2.08, called d3ldqb1