Lineage for d3ldqb_ (3ldq B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 908235Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 908445Superfamily a.7.7: BAG domain [63491] (1 family) (S)
  5. 908446Family a.7.7.1: BAG domain [63492] (5 proteins)
    Pfam PF02179
    this is a repeat family; one repeat unit is 1hx1 B:151-261 found in domain
  6. 908465Protein automated matches [191022] (1 species)
    not a true protein
  7. 908466Species Human (Homo sapiens) [TaxId:9606] [188815] (7 PDB entries)
  8. 908467Domain d3ldqb_: 3ldq B: [180199]
    automated match to d1hx1b_
    complexed with 3p1

Details for d3ldqb_

PDB Entry: 3ldq (more details), 1.9 Å

PDB Description: Crystal structure of HSC70/BAG1 in complex with small molecule inhibitor
PDB Compounds: (B:) BAG family molecular chaperone regulator 1

SCOPe Domain Sequences for d3ldqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ldqb_ a.7.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gnspqeevelkklkhleksvekiadqleelnkeltgiqqgflpkdlqaealckldrrvka
tieqfmkileeidtlilpenfkdsrlkrkglvkkvqaflaecdtveqnicq

SCOPe Domain Coordinates for d3ldqb_:

Click to download the PDB-style file with coordinates for d3ldqb_.
(The format of our PDB-style files is described here.)

Timeline for d3ldqb_: