Lineage for d3lbje_ (3lbj E:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1088952Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1088953Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1089009Family a.42.1.0: automated matches [191556] (1 protein)
    not a true family
  6. 1089010Protein automated matches [190960] (1 species)
    not a true protein
  7. 1089011Species Human (Homo sapiens) [TaxId:9606] [188578] (10 PDB entries)
  8. 1089015Domain d3lbje_: 3lbj E: [180162]
    automated match to d1ycqa_
    complexed with so4, ww8

Details for d3lbje_

PDB Entry: 3lbj (more details), 1.5 Å

PDB Description: structure of human mdmx protein in complex with a small molecule inhibitor
PDB Compounds: (E:) Protein Mdm4

SCOPe Domain Sequences for d3lbje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lbje_ a.42.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgel
lgrqsfsvkdpsplydmlrknlv

SCOPe Domain Coordinates for d3lbje_:

Click to download the PDB-style file with coordinates for d3lbje_.
(The format of our PDB-style files is described here.)

Timeline for d3lbje_: