Class a: All alpha proteins [46456] (284 folds) |
Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily) core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets duplication: consists of two structural repeats |
Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) binds to the transactivation domain of human p53 |
Family a.42.1.0: automated matches [191556] (1 protein) not a true family |
Protein automated matches [190960] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188578] (10 PDB entries) |
Domain d3lbje_: 3lbj E: [180162] automated match to d1ycqa_ complexed with so4, ww8 |
PDB Entry: 3lbj (more details), 1.5 Å
SCOPe Domain Sequences for d3lbje_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lbje_ a.42.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgel lgrqsfsvkdpsplydmlrknlv
Timeline for d3lbje_: