Lineage for d3l9ma_ (3l9m A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2586596Protein cAMP-dependent PK, catalytic subunit [56116] (7 species)
    AGC group; PKA subfamily; serine/threonine kinase
  7. 2586715Species Pig (Sus scrofa) [TaxId:9823] [56117] (9 PDB entries)
  8. 2586718Domain d3l9ma_: 3l9m A: [180120]
    automated match to d1cmke_
    complexed with l9m; mutant

Details for d3l9ma_

PDB Entry: 3l9m (more details), 1.9 Å

PDB Description: Crystal structure of PKAB3 (pka triple mutant V123A, L173M, Q181K) with compound 18
PDB Compounds: (A:) cAMP-dependent protein kinase catalytic subunit alpha

SCOPe Domain Sequences for d3l9ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l9ma_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Pig (Sus scrofa) [TaxId: 9823]}
eqesvkeflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgnhya
mkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyapggemfs
hlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenlmidqqgyikvtdfgfakr
vkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyeki
vsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkv
eapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

SCOPe Domain Coordinates for d3l9ma_:

Click to download the PDB-style file with coordinates for d3l9ma_.
(The format of our PDB-style files is described here.)

Timeline for d3l9ma_: