Lineage for d3l7pc_ (3l7p C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1414737Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1414738Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 1414812Protein automated matches [190670] (6 species)
    not a true protein
  7. 1414824Species Streptococcus mutans [TaxId:1309] [189585] (1 PDB entry)
  8. 1414827Domain d3l7pc_: 3l7p C: [180054]
    automated match to d1qy7a_

Details for d3l7pc_

PDB Entry: 3l7p (more details), 2 Å

PDB Description: Crystal structure of SMU.1657c, Putative nitrogen regulatory protein PII from streptococcus mutans
PDB Compounds: (C:) Putative nitrogen regulatory protein PII

SCOPe Domain Sequences for d3l7pc_:

Sequence, based on SEQRES records: (download)

>d3l7pc_ d.58.5.1 (C:) automated matches {Streptococcus mutans [TaxId: 1309]}
smkkieaiirsdkledlkaalvqsgfikgmtisqvlgfgnqrgyteyvrgqkitptllak
vkveivahdaaveemittisqavktgevgdgkifvspvdeivrir

Sequence, based on observed residues (ATOM records): (download)

>d3l7pc_ d.58.5.1 (C:) automated matches {Streptococcus mutans [TaxId: 1309]}
smkkieaiirsdkledlkaalvqsgfikgmtisqvlgfgntptllakvkveivahdaave
emittisqavktgegdgkifvspvdeivrir

SCOPe Domain Coordinates for d3l7pc_:

Click to download the PDB-style file with coordinates for d3l7pc_.
(The format of our PDB-style files is described here.)

Timeline for d3l7pc_: