Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
Protein automated matches [190670] (6 species) not a true protein |
Species Streptococcus mutans [TaxId:1309] [189585] (1 PDB entry) |
Domain d3l7pf_: 3l7p F: [180057] automated match to d1qy7a_ |
PDB Entry: 3l7p (more details), 2 Å
SCOPe Domain Sequences for d3l7pf_:
Sequence, based on SEQRES records: (download)
>d3l7pf_ d.58.5.1 (F:) automated matches {Streptococcus mutans [TaxId: 1309]} smkkieaiirsdkledlkaalvqsgfikgmtisqvlgfgnqrgyteyvrgqkitptllak vkveivahdaaveemittisqavktgevgdgkifvspvdeivri
>d3l7pf_ d.58.5.1 (F:) automated matches {Streptococcus mutans [TaxId: 1309]} smkkieaiirsdkledlkaalvqsgfikgmtisqvlgfgtllakvkveivahdaaveemi ttisqavktgevgdgkifvspvdeivri
Timeline for d3l7pf_: