| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
| Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
| Protein automated matches [190670] (7 species) not a true protein |
| Species Streptococcus mutans [TaxId:1309] [189585] (1 PDB entry) |
| Domain d3l7pc1: 3l7p C:1-104 [180054] Other proteins in same PDB: d3l7pc2, d3l7pd2, d3l7pe2, d3l7pf2 automated match to d1qy7a_ |
PDB Entry: 3l7p (more details), 2 Å
SCOPe Domain Sequences for d3l7pc1:
Sequence, based on SEQRES records: (download)
>d3l7pc1 d.58.5.1 (C:1-104) automated matches {Streptococcus mutans [TaxId: 1309]}
mkkieaiirsdkledlkaalvqsgfikgmtisqvlgfgnqrgyteyvrgqkitptllakv
kveivahdaaveemittisqavktgevgdgkifvspvdeivrir
>d3l7pc1 d.58.5.1 (C:1-104) automated matches {Streptococcus mutans [TaxId: 1309]}
mkkieaiirsdkledlkaalvqsgfikgmtisqvlgfgntptllakvkveivahdaavee
mittisqavktgegdgkifvspvdeivrir
Timeline for d3l7pc1: