Lineage for d3l7pa_ (3l7p A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2193923Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2193924Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 2194000Protein automated matches [190670] (6 species)
    not a true protein
  7. 2194032Species Streptococcus mutans [TaxId:1309] [189585] (1 PDB entry)
  8. 2194033Domain d3l7pa_: 3l7p A: [180052]
    Other proteins in same PDB: d3l7pc2, d3l7pd2, d3l7pe2, d3l7pf2
    automated match to d1qy7a_

Details for d3l7pa_

PDB Entry: 3l7p (more details), 2 Å

PDB Description: Crystal structure of SMU.1657c, Putative nitrogen regulatory protein PII from streptococcus mutans
PDB Compounds: (A:) Putative nitrogen regulatory protein PII

SCOPe Domain Sequences for d3l7pa_:

Sequence, based on SEQRES records: (download)

>d3l7pa_ d.58.5.1 (A:) automated matches {Streptococcus mutans [TaxId: 1309]}
mkkieaiirsdkledlkaalvqsgfikgmtisqvlgfgnqrgyteyvrgqkitptllakv
kveivahdaaveemittisqavktgevgdgkifvspvdeivri

Sequence, based on observed residues (ATOM records): (download)

>d3l7pa_ d.58.5.1 (A:) automated matches {Streptococcus mutans [TaxId: 1309]}
mkkieaiirsdkledlkaalvqsgfikgmtisqvlgfgtllakvkveivahdaaveemit
tisqavktggkifvspvdeivri

SCOPe Domain Coordinates for d3l7pa_:

Click to download the PDB-style file with coordinates for d3l7pa_.
(The format of our PDB-style files is described here.)

Timeline for d3l7pa_: