SCOPe 2.06: Domain d3l7pf1: 3l7p F:1-103

Lineage for d3l7pf1 (3l7p F:1-103)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein automated matches [190670] (6 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:1309] [189585] (1 PDB entry)

8. Domain d3l7pf1: 3l7p F:1-103 [180057]
   Other proteins in same PDB: d3l7pc2, d3l7pd2, d3l7pe2, d3l7pf2
   automated match to d1qy7a_

Details for d3l7pf1

PDB Entry: 3l7p, 2 Å

PDB Description: Crystal structure of SMU.1657c, Putative nitrogen regulatory protein PII from streptococcus mutans

PDB Compounds: (F:) Putative nitrogen regulatory protein PII

SCOPe Domain Sequences for d3l7pf1:

Sequence, based on SEQRES records:

>d3l7pf1 d.58.5.1 (F:1-103) automated matches {Streptococcus mutans [TaxId: 1309]}
mkkieaiirsdkledlkaalvqsgfikgmtisqvlgfgnqrgyteyvrgqkitptllakv
kveivahdaaveemittisqavktgevgdgkifvspvdeivri

Sequence, based on observed residues (ATOM records):

>d3l7pf1 d.58.5.1 (F:1-103) automated matches {Streptococcus mutans [TaxId: 1309]}
mkkieaiirsdkledlkaalvqsgfikgmtisqvlgfgtllakvkveivahdaaveemit
tisqavktgevgdgkifvspvdeivri

Timeline for d3l7pf1:

• d3l7pf1 first appeared in SCOPe 2.01, called d3l7pf_
  
• d3l7pf1 was called d3l7pf_ in SCOPe 2.05
  
• d3l7pf1 appears in SCOPe 2.07
  
• d3l7pf1 appears in the current release, SCOPe 2.08