Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) location - matrix side of the bc1 complex automatically mapped to Pfam PF02271 |
Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins) probably important for the complex assembly, caps the matrix face of cytochrome b |
Protein automated matches [190325] (4 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [189228] (8 PDB entries) |
Domain d3l75s_: 3l75 S: [180037] Other proteins in same PDB: d3l75a1, d3l75a2, d3l75b1, d3l75b2, d3l75c1, d3l75c2, d3l75d1, d3l75d2, d3l75e1, d3l75e2, d3l75g_, d3l75h_, d3l75j_, d3l75n1, d3l75n2, d3l75o1, d3l75o2, d3l75p1, d3l75p2, d3l75q1, d3l75q2, d3l75r1, d3l75r2, d3l75t_, d3l75u_, d3l75w_ automated match to d1sqpf1 complexed with azi, bog, cdl, fes, fnm, hec, hem, pee, unl, uq |
PDB Entry: 3l75 (more details), 2.79 Å
SCOPe Domain Sequences for d3l75s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l75s_ f.27.1.1 (S:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} grlmdrirkwyynaagfnkyglmrddtlyedddvkealkrlpedlynermfrikraldls lkhrilpkeqwvkyeedkpylepylkevirerlereawnkk
Timeline for d3l75s_:
View in 3D Domains from other chains: (mouse over for more information) d3l75a1, d3l75a2, d3l75b1, d3l75b2, d3l75c1, d3l75c2, d3l75d1, d3l75d2, d3l75e1, d3l75e2, d3l75f_, d3l75g_, d3l75h_, d3l75j_, d3l75n1, d3l75n2, d3l75o1, d3l75o2, d3l75p1, d3l75p2, d3l75q1, d3l75q2, d3l75r1, d3l75r2, d3l75t_, d3l75u_, d3l75w_ |