| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) ![]() location - matrix side of the bc1 complex |
| Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins) probably important for the complex assembly, caps the matrix face of cytochrome b |
| Protein automated matches [190325] (3 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [189228] (4 PDB entries) |
| Domain d3l75s_: 3l75 S: [180037] Other proteins in same PDB: d3l75g_, d3l75h_, d3l75j_, d3l75t_, d3l75u_, d3l75w_ automated match to d1sqpf1 complexed with azi, bog, cdl, fes, fnm, hec, hem, pee, unl, uq |
PDB Entry: 3l75 (more details), 2.79 Å
SCOPe Domain Sequences for d3l75s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l75s_ f.27.1.1 (S:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
grlmdrirkwyynaagfnkyglmrddtlyedddvkealkrlpedlynermfrikraldls
lkhrilpkeqwvkyeedkpylepylkevirerlereawnkk
Timeline for d3l75s_: