SCOPe 2.01: Domain d3l5sb_: 3l5s B:

Lineage for d3l5sb_ (3l5s B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.3: MIF-related [55339] (3 proteins)

6. Protein Microphage migration inhibition factor (MIF) [55340] (6 species)
   synonym: glycosylation-inhibiting factor (GIF)

7. Species Human (Homo sapiens) [TaxId:9606] [55341] (27 PDB entries)

8. Domain d3l5sb_: 3l5s B: [179976]
   automated match to d1gcza_
   complexed with 88x, so4

Details for d3l5sb_

PDB Entry: 3l5s, 1.86 Å

PDB Description: crystal structure of macrophage migration inhibitory factor (mif) with imidazopyrimidinylphenyl inhibitor at 1.86a resolution

PDB Compounds: (B:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d3l5sb_:

Sequence; same for both SEQRES and ATOM records:

>d3l5sb_ d.80.1.3 (B:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfaleh

Timeline for d3l5sb_:

• d3l5sb_ is new in SCOPe 2.01-stable
  
• d3l5sb_ appears in SCOPe 2.02
  
• d3l5sb_ appears in the current release, SCOPe 2.08, called d3l5sb1