![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Leishmania infantum [TaxId:5671] [189170] (1 PDB entry) |
![]() | Domain d3l4da1: 3l4d A:32-476 [179932] Other proteins in same PDB: d3l4da2, d3l4db2, d3l4dc2, d3l4dd2 automated match to d1x8va_ complexed with hem, n8e, tpf |
PDB Entry: 3l4d (more details), 2.75 Å
SCOPe Domain Sequences for d3l4da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l4da1 a.104.1.0 (A:32-476) automated matches {Leishmania infantum [TaxId: 5671]} ppvvhgttpfvghiiqfgkdplgfmlkakkkyggiftmnicgnritvvgdvhqhskfftp rneilsprevysfmvpvfgegvayaapyprmreqlnflaeeltvakfqnfapsiqhevrk fmkanwnkdegeinilddcsamiintacqclfgedlrkrldarqfaqllakmesclipaa vflpwilklplpqsyrcrdaraelqdilseiiiarekeeaqkdtntsdllagllgavyrd gtrmsqhevcgmivaamfagqhtstitttwsllhlmdprnkrhlaklhqeidefpaqlny dnvmeempfaeqcaresirrdpplvmlmrkvlkpvqvgkyvvpegdiiacspllshqdee afpnprewnpernmklvdgafcgfgagvhkcigekfgllqvktvlatvlrdydfellgpl pepnyhtmvvgptasqcrvkyikkk
Timeline for d3l4da1: