Lineage for d3l4db1 (3l4d B:32-476)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005695Species Leishmania infantum [TaxId:5671] [189170] (1 PDB entry)
  8. 2005697Domain d3l4db1: 3l4d B:32-476 [179933]
    Other proteins in same PDB: d3l4da2, d3l4db2, d3l4dc2, d3l4dd2
    automated match to d1x8va_
    complexed with hem, n8e, tpf

Details for d3l4db1

PDB Entry: 3l4d (more details), 2.75 Å

PDB Description: Crystal structure of sterol 14-alpha demethylase (CYP51) from Leishmania infantum in complex with fluconazole
PDB Compounds: (B:) Sterol 14-alpha demethylase

SCOPe Domain Sequences for d3l4db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l4db1 a.104.1.0 (B:32-476) automated matches {Leishmania infantum [TaxId: 5671]}
ppvvhgttpfvghiiqfgkdplgfmlkakkkyggiftmnicgnritvvgdvhqhskfftp
rneilsprevysfmvpvfgegvayaapyprmreqlnflaeeltvakfqnfapsiqhevrk
fmkanwnkdegeinilddcsamiintacqclfgedlrkrldarqfaqllakmesclipaa
vflpwilklplpqsyrcrdaraelqdilseiiiarekeeaqkdtntsdllagllgavyrd
gtrmsqhevcgmivaamfagqhtstitttwsllhlmdprnkrhlaklhqeidefpaqlny
dnvmeempfaeqcaresirrdpplvmlmrkvlkpvqvgkyvvpegdiiacspllshqdee
afpnprewnpernmklvdgafcgfgagvhkcigekfgllqvktvlatvlrdydfellgpl
pepnyhtmvvgptasqcrvkyikkk

SCOPe Domain Coordinates for d3l4db1:

Click to download the PDB-style file with coordinates for d3l4db1.
(The format of our PDB-style files is described here.)

Timeline for d3l4db1: