![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein automated matches [190047] (37 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries) |
![]() | Domain d3l43c_: 3l43 C: [179927] automated match to d2akab1 complexed with gdp, unx |
PDB Entry: 3l43 (more details), 2.27 Å
SCOPe Domain Sequences for d3l43c_:
Sequence, based on SEQRES records: (download)
>d3l43c_ c.37.1.8 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qiavvggqsagkssvlenfvgrdflprgsgivtrrplvlqlitskaeyaeflhckgkkft dfdevrleieaetdrvtgmnkgissipinlrvysphvlnltlidlpgitkvpvgdqppdi eyqiremimqfitrenclilavtpantdlansdalklakevdpqglrtigvitkldlmde gtdardvlenkllplrrgyvgvvnrsqkdidgkkdikaamlaerkfflshpayrhiadrm gtphlqkvlnq
>d3l43c_ c.37.1.8 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qiavvggqsagkssvlenfvgrdflprtrrplvlqlitskaeyaeflhckgkkftdfdev rleieaetdissipinlrvysphvlnltlidlpgitkvpvgdqppdieyqiremimqfit renclilavtpantdlansdalklakevdpqglrtigvitkldlmdegtdardvlenkll plrrgyvgvvnrsqkdidgkkdikaamlaerkfflshpayrhiadrmgtphlqkvlnq
Timeline for d3l43c_: