SCOPe 2.01: Domain d3l1ya_: 3l1y A:

Lineage for d3l1ya_ (3l1y A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)

7. Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (10 PDB entries)
   Uniprot P62837
   E2-17 kDa 2

8. Domain d3l1ya_: 3l1y A: [179862]
   automated match to d1ur6a_

Details for d3l1ya_

PDB Entry: 3l1y, 1.6 Å

PDB Description: Crystal structure of human UBC4 E2 conjugating enzyme

PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d3l1ya_:

Sequence; same for both SEQRES and ATOM records:

>d3l1ya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
hhmnsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltih
fptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnp
ddplvpeiariyqtdrekynriarewtqkyam

Timeline for d3l1ya_:

• d3l1ya_ is new in SCOPe 2.01-stable
  
• d3l1ya_ appears in SCOPe 2.02
  
• d3l1ya_ appears in the current release, SCOPe 2.08, called d3l1ya1