Lineage for d1ur6a_ (1ur6 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021591Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1021592Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1021593Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1021601Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1021698Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (10 PDB entries)
    Uniprot P62837
    E2-17 kDa 2
  8. 1021708Domain d1ur6a_: 1ur6 A: [99811]
    Other proteins in same PDB: d1ur6b_
    complexed with zn

Details for d1ur6a_

PDB Entry: 1ur6 (more details)

PDB Description: nmr based structural model of the ubch5b-cnot4 complex
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2-17 kda 2

SCOPe Domain Sequences for d1ur6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ur6a_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d1ur6a_:

Click to download the PDB-style file with coordinates for d1ur6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ur6a_: