SCOPe 2.02: Domain d3l0fa_: 3l0f A:

Lineage for d3l0fa_ (3l0f A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein Phycocyanin alpha subunit [88933] (8 species)

7. Species Thermosynechococcus elongatus [TaxId:197221] [189582] (1 PDB entry)

8. Domain d3l0fa_: 3l0f A: [179840]
   Other proteins in same PDB: d3l0fb_
   automated match to d1jboa_
   complexed with cyc

Details for d3l0fa_

PDB Entry: 3l0f, 1.35 Å

PDB Description: High resolution structure of C-Phycocyanin from Thermosynechococcus elongatus

PDB Compounds: (A:) C-phycocyanin alpha chain

SCOPe Domain Sequences for d3l0fa_:

Sequence; same for both SEQRES and ATOM records:

>d3l0fa_ a.1.1.3 (A:) Phycocyanin alpha subunit {Thermosynechococcus elongatus [TaxId: 197221]}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmvtyclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

Timeline for d3l0fa_:

• d3l0fa_ first appeared in SCOPe 2.01
  
• d3l0fa_ appears in SCOPe 2.03
  
• d3l0fa_ appears in the current release, SCOPe 2.08