SCOPe 2.06: Domain d3ku0a_: 3ku0 A:

Lineage for d3ku0a_ (3ku0 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.0: automated matches [191615] (1 protein)
   not a true family

6. Protein automated matches [191124] (7 species)
   not a true protein

7. Species Gelonium multiflorum [TaxId:3979] [189202] (2 PDB entries)

8. Domain d3ku0a_: 3ku0 A: [179700]
   automated match to d1uq5a_
   complexed with ade, nag

Details for d3ku0a_

PDB Entry: 3ku0, 1.9 Å

PDB Description: structure of gap31 with adenine at its binding pocket

PDB Compounds: (A:) Ribosome-inactivating protein gelonin

SCOPe Domain Sequences for d3ku0a_:

Sequence; same for both SEQRES and ATOM records:

>d3ku0a_ d.165.1.0 (A:) automated matches {Gelonium multiflorum [TaxId: 3979]}
gldtvsfstkgatyityvnflnelrvklkpegnshgipllrkkcddpgkcfvlvalsndn
gqlaeiaidvtsvyvvgyqvrnrsyffkdapdaayeglfkntiktrlhfggsypslegek
ayrettdlgieplrigikkldenaidnykpteiassllvviqmvseaarftfienqirnn
fqqrirpanntislenkwgklsfqirtsgangmfseavelerangkkyyvtavdqvkpki
allkfvdkdpk

Timeline for d3ku0a_:

• d3ku0a_ first appeared in SCOPe 2.01
  
• d3ku0a_ appears in SCOPe 2.05
  
• d3ku0a_ appears in SCOPe 2.07
  
• d3ku0a_ appears in the current release, SCOPe 2.08