Lineage for d3ktkn_ (3ktk N:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1584360Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1584361Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. Protein automated matches [190149] (7 species)
    not a true protein
  7. 1584528Species Bacillus subtilis [TaxId:1423] [189283] (5 PDB entries)
  8. 1584563Domain d3ktkn_: 3ktk N: [179694]
    automated match to d1tyfa_

Details for d3ktkn_

PDB Entry: 3ktk (more details), 2.6 Å

PDB Description: Structure of ClpP in complex with ADEP2 in triclinic crystal form
PDB Compounds: (N:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3ktkn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ktkn_ c.14.1.1 (N:) automated matches {Bacillus subtilis [TaxId: 1423]}
diysrllkdriimlgsaiddnvansivsqllflaaedpekeislyinspggsitagmaiy
dtmqfikpkvsticigmaasmgafllaagekgkryalpnsevmihqplggaqgqateiei
aakrilllrdklnkvlaertgqplevierdtdrdnfksaeealeyglidkilth

SCOPe Domain Coordinates for d3ktkn_:

Click to download the PDB-style file with coordinates for d3ktkn_.
(The format of our PDB-style files is described here.)

Timeline for d3ktkn_: