SCOPe 2.01: Domain d3ksga_: 3ksg A:

Lineage for d3ksga_ (3ksg A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.0: automated matches [191507] (1 protein)
   not a true family

6. Protein automated matches [190838] (3 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:282458] [189340] (4 PDB entries)

8. Domain d3ksga_: 3ksg A: [179653]
   automated match to d1vhma_
   complexed with sme

Details for d3ksga_

PDB Entry: 3ksg, 2.3 Å

PDB Description: structure of fRMsr of Staphylococcus aureus (complex with substrate)

PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3ksga_:

Sequence; same for both SEQRES and ATOM records:

>d3ksga_ d.110.2.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
ttinptnytllkkqaasliedehhmiailsnmsallndnldqinwvgfylleqnelilgp
fqghpasvhipigkgvcgtavserrtqvvadvhqfkghiacdanskseivvpifkddkii
gvldidapitdrfddndkehleaivkiiekqla

Timeline for d3ksga_:

• d3ksga_ is new in SCOPe 2.01-stable
  
• d3ksga_ appears in SCOPe 2.02
  
• d3ksga_ appears in the current release, SCOPe 2.08