Lineage for d3ksgb_ (3ksg B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037952Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1038010Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 1038094Family d.110.2.0: automated matches [191507] (1 protein)
    not a true family
  6. 1038095Protein automated matches [190838] (3 species)
    not a true protein
  7. 1038101Species Staphylococcus aureus [TaxId:282458] [189340] (4 PDB entries)
  8. 1038113Domain d3ksgb_: 3ksg B: [179654]
    automated match to d1vhma_
    complexed with sme

Details for d3ksgb_

PDB Entry: 3ksg (more details), 2.3 Å

PDB Description: structure of fRMsr of Staphylococcus aureus (complex with substrate)
PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d3ksgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ksgb_ d.110.2.0 (B:) automated matches {Staphylococcus aureus [TaxId: 282458]}
ttinptnytllkkqaasliedehhmiailsnmsallndnldqinwvgfylleqnelilgp
fqghpasvhipigkgvcgtavserrtqvvadvhqfkghiacdanskseivvpifkddkii
gvldidapitdrfddndkehleaivkiiekqla

SCOPe Domain Coordinates for d3ksgb_:

Click to download the PDB-style file with coordinates for d3ksgb_.
(The format of our PDB-style files is described here.)

Timeline for d3ksgb_: