Lineage for d3krdt_ (3krd T:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2995215Species Mycobacterium tuberculosis [TaxId:1773] [187707] (16 PDB entries)
  8. 2995319Domain d3krdt_: 3krd T: [179613]
    automated match to d1q5qh_
    complexed with feb

Details for d3krdt_

PDB Entry: 3krd (more details), 2.5 Å

PDB Description: Crystal Structure of Mycobacterium Tuberculosis Proteasome in complex with Fellutamide B
PDB Compounds: (T:) Proteasome subunit beta

SCOPe Domain Sequences for d3krdt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3krdt_ d.153.1.4 (T:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs

SCOPe Domain Coordinates for d3krdt_:

Click to download the PDB-style file with coordinates for d3krdt_.
(The format of our PDB-style files is described here.)

Timeline for d3krdt_: