Lineage for d1bdxa2 (1bdx A:65-142)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 356779Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 356835Superfamily a.60.2: RuvA domain 2-like [47781] (3 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 356836Family a.60.2.1: DNA helicase RuvA subunit, middle domain [47782] (1 protein)
  6. 356837Protein DNA helicase RuvA subunit, middle domain [47783] (3 species)
    tetramer; binds Holliday junction
  7. 356838Species Escherichia coli [TaxId:562] [47784] (5 PDB entries)
  8. 356844Domain d1bdxa2: 1bdx A:65-142 [17951]
    Other proteins in same PDB: d1bdxa1, d1bdxa3, d1bdxb1, d1bdxb3, d1bdxc1, d1bdxc3, d1bdxd1, d1bdxd3

Details for d1bdxa2

PDB Entry: 1bdx (more details), 6 Å

PDB Description: e. coli dna helicase ruva with bound dna holliday junction, alpha carbons and phosphate atoms only

SCOP Domain Sequences for d1bdxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdxa2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli}
nkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkktaerl
ivemkdrfkglhgdlftp

SCOP Domain Coordinates for d1bdxa2:

Click to download the PDB-style file with coordinates for d1bdxa2.
(The format of our PDB-style files is described here.)

Timeline for d1bdxa2: