Lineage for d1bdxb3 (1bdx B:1-64)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 374537Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 374580Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein)
    barrel, closed; n=5, S=10
  6. 374581Protein DNA helicase RuvA subunit, N-terminal domain [50260] (3 species)
    tetramer; binds Holliday junction
  7. 374582Species Escherichia coli [TaxId:562] [50261] (5 PDB entries)
  8. 374589Domain d1bdxb3: 1bdx B:1-64 [25271]
    Other proteins in same PDB: d1bdxa1, d1bdxa2, d1bdxb1, d1bdxb2, d1bdxc1, d1bdxc2, d1bdxd1, d1bdxd2

Details for d1bdxb3

PDB Entry: 1bdx (more details), 6 Å

PDB Description: e. coli dna helicase ruva with bound dna holliday junction, alpha carbons and phosphate atoms only

SCOP Domain Sequences for d1bdxb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdxb3 b.40.4.2 (B:1-64) DNA helicase RuvA subunit, N-terminal domain {Escherichia coli}
migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
ygfn

SCOP Domain Coordinates for d1bdxb3:

Click to download the PDB-style file with coordinates for d1bdxb3.
(The format of our PDB-style files is described here.)

Timeline for d1bdxb3: