SCOPe 2.05: Domain d3kovb_: 3kov B:

Lineage for d3kovb_ (3kov B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.88: SRF-like [55454] (1 superfamily)
   alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet

4. Superfamily d.88.1: SRF-like [55455] (1 family)

5. Family d.88.1.1: SRF-like [55456] (5 proteins)

6. Protein automated matches [191130] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189221] (3 PDB entries)

8. Domain d3kovb_: 3kov B: [179509]
   automated match to d1n6jb_
   protein/DNA complex

Details for d3kovb_

PDB Entry: 3kov, 2.9 Å

PDB Description: structure of mef2a bound to dna reveals a completely folded mads- box/mef2 domain that recognizes dna and recruits transcription co- factors

PDB Compounds: (B:) myocyte-specific enhancer factor 2a

SCOPe Domain Sequences for d3kovb_:

Sequence; same for both SEQRES and ATOM records:

>d3kovb_ d.88.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
mdkvllkyteynephesrtnsdivealnkk

Timeline for d3kovb_:

• d3kovb_ first appeared in SCOPe 2.01
  
• d3kovb_ appears in SCOPe 2.04
  
• d3kovb_ appears in SCOPe 2.06
  
• d3kovb_ appears in the current release, SCOPe 2.08