PDB entry 3kov
View 3kov on RCSB PDB site
Description: Structure of MEF2A bound to DNA reveals a completely folded MADS-box/MEF2 domain that recognizes DNA and recruits transcription co-factors
Class: transcription/DNA
Keywords: MADS-box/MEF2 domain, transcription co-factors, protein-DNA complex, protein-protein docking, Acetylation, Activator, Alternative splicing, Apoptosis, Developmental protein, Differentiation, Disease mutation, DNA-binding, Isopeptide bond, Neurogenesis, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Ubl conjugation, TRANSCRIPTION-DNA complex
Deposited on
2009-11-14, released
2010-02-16
The last revision prior to the SCOPe 2.05 freeze date was dated
2010-03-23, with a file datestamp of
2010-03-19.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.224
AEROSPACI score: 0.23
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: myocyte-specific enhancer factor 2a
Species: Homo sapiens [TaxId:9606]
Gene: MEF2A, MEF2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d3kova_ - Chain 'B':
Compound: myocyte-specific enhancer factor 2a
Species: Homo sapiens [TaxId:9606]
Gene: MEF2A, MEF2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d3kovb_ - Chain 'C':
Compound: DNA (5'-d(*ap*ap*cp*tp*ap*tp*tp*tp*ap*tp*ap*ap*g)-3')
- Chain 'D':
Compound: DNA (5'-d(*tp*cp*tp*tp*ap*tp*ap*ap*ap*tp*ap*gp*t)-3')
- Chain 'I':
Compound: myocyte-specific enhancer factor 2a
Species: Homo sapiens [TaxId:9606]
Gene: MEF2A, MEF2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d3kovi_ - Chain 'J':
Compound: myocyte-specific enhancer factor 2a
Species: Homo sapiens [TaxId:9606]
Gene: MEF2A, MEF2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d3kovj_ - Chain 'K':
Compound: DNA (5'-d(*ap*ap*cp*tp*ap*tp*tp*tp*ap*tp*ap*ap*g)-3')
- Chain 'L':
Compound: DNA (5'-d(*tp*cp*tp*tp*ap*tp*ap*ap*ap*tp*ap*gp*t)-3')
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3kovA (A:)
grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
mdkvllkyteynephesrtnsdivealnkk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3kovB (B:)
grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
mdkvllkyteynephesrtnsdivealnkk
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'I':
Sequence; same for both SEQRES and ATOM records: (download)
>3kovI (I:)
grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
mdkvllkyteynephesrtnsdivealnkk
- Chain 'J':
Sequence; same for both SEQRES and ATOM records: (download)
>3kovJ (J:)
grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
mdkvllkyteynephesrtnsdivealnkk
- Chain 'K':
No sequence available.
- Chain 'L':
No sequence available.