Lineage for d1n6jb_ (1n6j B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.88: SRF-like [55454] (1 superfamily)
alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheetSuperfamily d.88.1: SRF-like [55455] (1 family) 
Family d.88.1.1: SRF-like [55456] (5 proteins) 
Protein Myocyte enhancer factor Mef2b core [103117] (1 species) Species Human (Homo sapiens) [TaxId:9606] [103118] (2 PDB entries)
Uniprot Q02080 2-91
Domain d1n6jb_: 1n6j B: [91687]
complexed with a cabin 1 peptide, chain G
protein/DNA complex
Details for d1n6jb_
PDB Entry: 1n6j (more details), 2.2 Å
PDB Description: structural basis of sequence-specific recruitment of histone deacetylases by myocyte enhancer factor-2
PDB Compounds: (B:) Myocyte-specific enhancer factor 2BSCOPe Domain Sequences for d1n6jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n6jb_ d.88.1.1 (B:) Myocyte enhancer factor Mef2b core {Human (Homo sapiens) [TaxId: 9606]}
grkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastd
mdrvllkyteysephesrtntdiletlkrr
SCOPe Domain Coordinates for d1n6jb_:
Click to download the PDB-style file with coordinates for d1n6jb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n6jb_:
- d1n6jb_ first appeared in SCOP 1.67
- d1n6jb_ appears in SCOPe 2.04
- d1n6jb_ appears in SCOPe 2.06
- d1n6jb_ appears in the current release, SCOPe 2.08
View in 3D
