![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.88: SRF-like [55454] (1 superfamily) alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet |
![]() | Superfamily d.88.1: SRF-like [55455] (1 family) ![]() |
![]() | Family d.88.1.1: SRF-like [55456] (5 proteins) |
![]() | Protein Myocyte enhancer factor Mef2b core [103117] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103118] (2 PDB entries) Uniprot Q02080 2-91 |
![]() | Domain d1n6jb_: 1n6j B: [91687] complexed with a cabin 1 peptide, chain G protein/DNA complex |
PDB Entry: 1n6j (more details), 2.2 Å
SCOPe Domain Sequences for d1n6jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n6jb_ d.88.1.1 (B:) Myocyte enhancer factor Mef2b core {Human (Homo sapiens) [TaxId: 9606]} grkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastd mdrvllkyteysephesrtntdiletlkrr
Timeline for d1n6jb_: