SCOPe 2.01: Domain d1hjpa2: 1hjp A:65-140

Lineage for d1hjpa2 (1hjp A:65-140)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.2: RuvA domain 2-like [47781] (7 families)
   duplication: contains two helix-hairpin-helix (HhH) motifs

5. Family a.60.2.1: DNA helicase RuvA subunit, middle domain [47782] (1 protein)

6. Protein DNA helicase RuvA subunit, middle domain [47783] (3 species)
   tetramer; binds Holliday junction

7. Species Escherichia coli [TaxId:562] [47784] (5 PDB entries)

8. Domain d1hjpa2: 1hjp A:65-140 [17947]
   Other proteins in same PDB: d1hjpa1, d1hjpa3

Details for d1hjpa2

PDB Entry: 1hjp, 2.5 Å

PDB Description: holliday junction binding protein ruva from e. coli

PDB Compounds: (A:) ruva

SCOPe Domain Sequences for d1hjpa2:

Sequence; same for both SEQRES and ATOM records:

>d1hjpa2 a.60.2.1 (A:65-140) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]}
nkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkktaerl
ivemkdrfkglhgdlf

Timeline for d1hjpa2:

• d1hjpa2 first appeared (with stable ids) in SCOP 1.55, called d1hjp_2
  
• d1hjpa2 appears in SCOP 1.75
  
• d1hjpa2 appears in SCOPe 2.02
  
• d1hjpa2 appears in the current release, SCOPe 2.08