Lineage for d1hjp_2 (1hjp 65-140)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 356779Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 356835Superfamily a.60.2: RuvA domain 2-like [47781] (3 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 356836Family a.60.2.1: DNA helicase RuvA subunit, middle domain [47782] (1 protein)
  6. 356837Protein DNA helicase RuvA subunit, middle domain [47783] (3 species)
    tetramer; binds Holliday junction
  7. 356838Species Escherichia coli [TaxId:562] [47784] (5 PDB entries)
  8. 356840Domain d1hjp_2: 1hjp 65-140 [17947]
    Other proteins in same PDB: d1hjp_1, d1hjp_3

Details for d1hjp_2

PDB Entry: 1hjp (more details), 2.5 Å

PDB Description: holliday junction binding protein ruva from e. coli

SCOP Domain Sequences for d1hjp_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjp_2 a.60.2.1 (65-140) DNA helicase RuvA subunit, middle domain {Escherichia coli}
nkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkktaerl
ivemkdrfkglhgdlf

SCOP Domain Coordinates for d1hjp_2:

Click to download the PDB-style file with coordinates for d1hjp_2.
(The format of our PDB-style files is described here.)

Timeline for d1hjp_2: