SCOPe 2.02: Domain d3kn7a_: 3kn7 A:

Lineage for d3kn7a_ (3kn7 A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein Ferric-binding protein FbpA [53867] (7 species)

7. Species Haemophilus influenzae [TaxId:727] [53868] (12 PDB entries)

8. Domain d3kn7a_: 3kn7 A: [179467]
   automated match to d1d9va_
   complexed with fe, po4; mutant

Details for d3kn7a_

PDB Entry: 3kn7, 1.71 Å

PDB Description: crystal structure of haemophilus influenzae y195a mutant holo ferric ion-binding protein a

PDB Compounds: (A:) Iron-utilization periplasmic protein

SCOPe Domain Sequences for d3kn7a_:

Sequence; same for both SEQRES and ATOM records:

>d3kn7a_ c.94.1.1 (A:) Ferric-binding protein FbpA {Haemophilus influenzae [TaxId: 727]}
ditvyngqhkeaatavakafeqetgikvtlnsgkseqlagqlkeegdktpadvfyteqta
tfadlseagllapiseqtiqqtaqkgvplapkkdwialsgrsrvvvydhtklsekdmeks
vldyatpkwkgkigyvstsgafleqvvalskmkgdkvalnwlkglkengklyaknsvalq
avengevpaalinnaywynlakekgvenlksrlyfvrhqdpgalvsysgaavlkasknqa
eaqkfvdflaskkgqealvaaraeyplradvvspfnlepyekleapvvsattaqdkehai
klieeagl

Timeline for d3kn7a_:

• d3kn7a_ first appeared in SCOPe 2.01
  
• d3kn7a_ appears in SCOPe 2.03
  
• d3kn7a_ appears in the current release, SCOPe 2.08