SCOP 1.67: Domain d1cuk_2: 1cuk 65-142

Lineage for d1cuk_2 (1cuk 65-142)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.2: RuvA domain 2-like [47781] (3 families)
   duplication: contains two helix-hairpin-helix (HhH) motifs

5. Family a.60.2.1: DNA helicase RuvA subunit, middle domain [47782] (1 protein)

6. Protein DNA helicase RuvA subunit, middle domain [47783] (3 species)
   tetramer; binds Holliday junction

7. Species Escherichia coli [TaxId:562] [47784] (5 PDB entries)

8. Domain d1cuk_2: 1cuk 65-142 [17946]
   Other proteins in same PDB: d1cuk_1, d1cuk_3

Details for d1cuk_2

PDB Entry: 1cuk, 1.9 Å

PDB Description: escherichia coli ruva protein at ph 4.9 and room temperature

SCOP Domain Sequences for d1cuk_2:

Sequence; same for both SEQRES and ATOM records:

>d1cuk_2 a.60.2.1 (65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli}
nkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkktaerl
ivemkdrfkglhgdlftp

Timeline for d1cuk_2:

• d1cuk_2 first appeared (with stable ids) in SCOP 1.55
  
• d1cuk_2 appears in SCOP 1.65
  
• d1cuk_2 appears in SCOP 1.69
  
• d1cuk_2 appears in the current release, SCOPe 2.08, called d1cuka2