Class a: All alpha proteins [46456] (202 folds) |
Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.2: RuvA domain 2-like [47781] (3 families) duplication: contains two helix-hairpin-helix (HhH) motifs |
Family a.60.2.1: DNA helicase RuvA subunit, middle domain [47782] (1 protein) |
Protein DNA helicase RuvA subunit, middle domain [47783] (3 species) tetramer; binds Holliday junction |
Species Escherichia coli [TaxId:562] [47784] (5 PDB entries) |
Domain d1cuk_2: 1cuk 65-142 [17946] Other proteins in same PDB: d1cuk_1, d1cuk_3 |
PDB Entry: 1cuk (more details), 1.9 Å
SCOP Domain Sequences for d1cuk_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cuk_2 a.60.2.1 (65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli} nkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkktaerl ivemkdrfkglhgdlftp
Timeline for d1cuk_2: