Lineage for d1cuka2 (1cuk A:65-142)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715662Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 2715663Family a.60.2.1: DNA helicase RuvA subunit, middle domain [47782] (1 protein)
  6. 2715664Protein DNA helicase RuvA subunit, middle domain [47783] (3 species)
    tetramer; binds Holliday junction
  7. 2715665Species Escherichia coli [TaxId:562] [47784] (5 PDB entries)
  8. 2715666Domain d1cuka2: 1cuk A:65-142 [17946]
    Other proteins in same PDB: d1cuka1, d1cuka3

Details for d1cuka2

PDB Entry: 1cuk (more details), 1.9 Å

PDB Description: escherichia coli ruva protein at ph 4.9 and room temperature
PDB Compounds: (A:) ruva protein

SCOPe Domain Sequences for d1cuka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cuka2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]}
nkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkktaerl
ivemkdrfkglhgdlftp

SCOPe Domain Coordinates for d1cuka2:

Click to download the PDB-style file with coordinates for d1cuka2.
(The format of our PDB-style files is described here.)

Timeline for d1cuka2: