Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (25 species) |
Species Human (Homo sapiens) [TaxId:9606] [46501] (196 PDB entries) Uniprot P68871 |
Domain d3kmfc_: 3kmf C: [179445] Other proteins in same PDB: d3kmfa_, d3kmfe_ automated match to d1dxtb_ complexed with dod, hem |
PDB Entry: 3kmf (more details), 2 Å
SCOPe Domain Sequences for d3kmfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kmfc_ a.1.1.2 (C:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]} vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk eftppvqaayqkvvagvanalahkyh
Timeline for d3kmfc_: