Lineage for d3kcgh_ (3kcg H:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2404660Protein Coagulation factor IXa, protease domain [50583] (2 species)
  7. 2404661Species Human (Homo sapiens) [TaxId:9606] [50585] (20 PDB entries)
  8. 2404668Domain d3kcgh_: 3kcg H: [179265]
    Other proteins in same PDB: d3kcgi_, d3kcgl_
    automated match to d1rfna_
    complexed with ca, mpd, ntp

Details for d3kcgh_

PDB Entry: 3kcg (more details), 1.7 Å

PDB Description: crystal structure of the antithrombin-factor ixa-pentasaccharide complex
PDB Compounds: (H:) Coagulation factor IXa heavy chain

SCOPe Domain Sequences for d3kcgh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kcgh_ b.47.1.2 (H:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnynaainkynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftiynnmfcagfheggrds
cqgdaggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt

SCOPe Domain Coordinates for d3kcgh_:

Click to download the PDB-style file with coordinates for d3kcgh_.
(The format of our PDB-style files is described here.)

Timeline for d3kcgh_: