![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Coagulation factor IXa, protease domain [50583] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50585] (16 PDB entries) |
![]() | Domain d3kcgh_: 3kcg H: [179265] Other proteins in same PDB: d3kcgi_, d3kcgl_ automated match to d1rfna_ complexed with ca, mpd, ntp |
PDB Entry: 3kcg (more details), 1.7 Å
SCOPe Domain Sequences for d3kcgh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kcgh_ b.47.1.2 (H:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee tehteqkrnviriiphhnynaainkynhdialleldeplvlnsyvtpiciadkeytnifl kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftiynnmfcagfheggrds cqgdaggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt
Timeline for d3kcgh_: