Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
Protein automated matches [190403] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187277] (24 PDB entries) |
Domain d3kbxd_: 3kbx D: [179246] automated match to d1b50a_ complexed with act, k |
PDB Entry: 3kbx (more details), 2.65 Å
SCOPe Domain Sequences for d3kbxd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kbxd_ d.9.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqkym sdlels
Timeline for d3kbxd_:
View in 3D Domains from other chains: (mouse over for more information) d3kbxa_, d3kbxb_, d3kbxc_, d3kbxe_ |