Lineage for d3k9eb_ (3k9e B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1181243Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1181244Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1181435Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 1181436Protein automated matches [190117] (18 species)
    not a true protein
  7. 1181462Species Escherichia coli [TaxId:217992] [189024] (2 PDB entries)
  8. 1181466Domain d3k9eb_: 3k9e B: [179210]
    automated match to d1wyea1

Details for d3k9eb_

PDB Entry: 3k9e (more details), 2.05 Å

PDB Description: crystal structure of a putative ribokinase ii (apo form) from e.coli
PDB Compounds: (B:) putative Ribokinase II

SCOPe Domain Sequences for d3k9eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k9eb_ c.72.1.0 (B:) automated matches {Escherichia coli [TaxId: 217992]}
lskvftigeilveimaskigqpfdqpgiwngpypsgapaifidqvtrlgvpcgiiscvgn
dgfgdinihrlaadgvdirgisvlpleatgsafvtyhnsgdrdfifniknaacgklsaqh
vdenilkdcthfhimgsslfsfhmvdavkkavtivkanggvisfdpnirkemldipemrd
alhfvleltdiympsegevlllsphstperaiagfleegvkevivkrgnqgasyysaneq
fhvesypveevdptgagdcfggawiacrqlgfdahralqyanacgalavtrrgpmegtsr
lmeietfiqrh

SCOPe Domain Coordinates for d3k9eb_:

Click to download the PDB-style file with coordinates for d3k9eb_.
(The format of our PDB-style files is described here.)

Timeline for d3k9eb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3k9ea_