Lineage for d1ffua1 (1ffu A:82-157)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539215Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 539216Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) (S)
    contains 2Fe-2S cluster
  5. 539217Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (6 proteins)
  6. 539230Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (2 species)
  7. 539231Species Hydrogenophaga pseudoflava [TaxId:47421] [47750] (2 PDB entries)
  8. 539234Domain d1ffua1: 1ffu A:82-157 [17917]
    Other proteins in same PDB: d1ffua2, d1ffub1, d1ffub2, d1ffuc1, d1ffuc2, d1ffud2, d1ffue1, d1ffue2, d1ffuf1, d1ffuf2

Details for d1ffua1

PDB Entry: 1ffu (more details), 2.35 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor

SCOP Domain Sequences for d1ffua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffua1 a.56.1.1 (A:82-157) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Hydrogenophaga pseudoflava}
nkgvlhavqegfykehglqcgfctpgmlmrayrflqenpnpteaeirmgmtgnlcrctgy
qnivkavqyaarklqe

SCOP Domain Coordinates for d1ffua1:

Click to download the PDB-style file with coordinates for d1ffua1.
(The format of our PDB-style files is described here.)

Timeline for d1ffua1: