SCOP 1.71: Domain d1ffud1: 1ffu D:82-157

Lineage for d1ffud1 (1ffu D:82-157)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
   core: 4 helices, bundle

4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family)
   contains 2Fe-2S cluster

5. Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (6 proteins)

6. Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (2 species)

7. Species Hydrogenophaga pseudoflava [TaxId:47421] [47750] (2 PDB entries)

8. Domain d1ffud1: 1ffu D:82-157 [17918]
   Other proteins in same PDB: d1ffua2, d1ffub1, d1ffub2, d1ffuc1, d1ffuc2, d1ffud2, d1ffue1, d1ffue2, d1ffuf1, d1ffuf2
   complexed with aro, cdp, csz, fad, fes

Details for d1ffud1

PDB Entry: 1ffu, 2.35 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor

SCOP Domain Sequences for d1ffud1:

Sequence; same for both SEQRES and ATOM records:

>d1ffud1 a.56.1.1 (D:82-157) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Hydrogenophaga pseudoflava}
nkgvlhavqegfykehglqcgfctpgmlmrayrflqenpnpteaeirmgmtgnlcrctgy
qnivkavqyaarklqe

Timeline for d1ffud1:

• d1ffud1 first appeared (with stable ids) in SCOP 1.55
  
• d1ffud1 appears in SCOP 1.69
  
• d1ffud1 appears in SCOP 1.73
  
• d1ffud1 appears in the current release, SCOPe 2.08