Lineage for d1ffue1 (1ffu E:7-146)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602004Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 602005Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 602006Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 602019Protein Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain [54672] (2 species)
  7. 602020Species Hydrogenophaga pseudoflava [TaxId:47421] [54674] (2 PDB entries)
  8. 602024Domain d1ffue1: 1ffu E:7-146 [38594]
    Other proteins in same PDB: d1ffua1, d1ffua2, d1ffub2, d1ffuc1, d1ffuc2, d1ffud1, d1ffud2, d1ffue2, d1ffuf1, d1ffuf2
    complexed with aro, cdp, csz, fad, fes

Details for d1ffue1

PDB Entry: 1ffu (more details), 2.35 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor

SCOP Domain Sequences for d1ffue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffue1 d.41.1.1 (E:7-146) Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain {Hydrogenophaga pseudoflava}
daearelalagmgasrlrkedarfiqgkgnyvddikmpgmlhmdivrapiahgrikkihk
daalampgvhavltaedlkplklhwmptlagdvaavladekvhfqmqevaiviaddryia
adaveavkveydelpvvidp

SCOP Domain Coordinates for d1ffue1:

Click to download the PDB-style file with coordinates for d1ffue1.
(The format of our PDB-style files is described here.)

Timeline for d1ffue1: