SCOPe 2.01: Domain d3k7sb_: 3k7s B:

Lineage for d3k7sb_ (3k7s B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
   3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold

4. Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families)

5. Family c.121.1.0: automated matches [191649] (1 protein)
   not a true family

6. Protein automated matches [191196] (1 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:353153] [189510] (4 PDB entries)

8. Domain d3k7sb_: 3k7s B: [179166]
   automated match to d1nn4b_
   complexed with r52

Details for d3k7sb_

PDB Entry: 3k7s, 1.9 Å

PDB Description: Complex of Trypanosoma cruzi ribose 5-phosphate isomerase type B with ribose 5-phosphate

PDB Compounds: (B:) Ribose 5-phosphate isomerase

SCOPe Domain Sequences for d3k7sb_:

Sequence; same for both SEQRES and ATOM records:

>d3k7sb_ c.121.1.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
trrvaigtdhpafaihenlilyvkeagdefvpvycgpktaesvdypdfasrvaemvarke
vefgvlacgsgigmsiaankvpgvraalchdhytaamsrihndanivcvgerttgvevir
eiiitflqtpfsgeerhvrriekiraieash

Timeline for d3k7sb_:

• d3k7sb_ is new in SCOPe 2.01-stable
  
• d3k7sb_ appears in SCOPe 2.02
  
• d3k7sb_ appears in the current release, SCOPe 2.08