![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold |
![]() | Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) ![]() |
![]() | Family c.121.1.0: automated matches [191649] (1 protein) not a true family |
![]() | Protein automated matches [191196] (1 species) not a true protein |
![]() | Species Trypanosoma cruzi [TaxId:353153] [189510] (4 PDB entries) |
![]() | Domain d3k7sd_: 3k7s D: [179168] automated match to d1nn4b_ complexed with r52 |
PDB Entry: 3k7s (more details), 1.9 Å
SCOPe Domain Sequences for d3k7sd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k7sd_ c.121.1.0 (D:) automated matches {Trypanosoma cruzi [TaxId: 353153]} trrvaigtdhpafaihenlilyvkeagdefvpvycgpktaesvdypdfasrvaemvarke vefgvlacgsgigmsiaankvpgvraalchdhytaamsrihndanivcvgerttgvevir eiiitflqtpfsgeerhvrriekiraieash
Timeline for d3k7sd_: