Lineage for d1alo_1 (1alo 81-193)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48597Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
  4. 48598Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) (S)
  5. 48599Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (3 proteins)
  6. 48600Protein Aldehyde oxidoreductase, domain 2 [47743] (2 species)
  7. 48603Species Desulfovibrio gigas [TaxId:879] [47744] (1 PDB entry)
  8. 48604Domain d1alo_1: 1alo 81-193 [17908]
    Other proteins in same PDB: d1alo_2, d1alo_3, d1alo_4

Details for d1alo_1

PDB Entry: 1alo (more details), 2 Å

PDB Description: aldehyde oxidoreductase
PDB Compounds: ( :)

SCOP Domain Sequences for d1alo_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1alo_1 a.56.1.1 (81-193) Aldehyde oxidoreductase, domain 2 {Desulfovibrio gigas}
qpenlhplqkawvlhggaqcgfcspgfivsakglldtnadpsredvrdwfqkhrnacrct
gykplvdavmdaaavingkkpetdlefkmpadgriwgskyprptavakvtgtl

SCOP Domain Coordinates for d1alo_1:

Click to download the PDB-style file with coordinates for d1alo_1.
(The format of our PDB-style files is described here.)

Timeline for d1alo_1: